DPCstruct | MC53611
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 93 ± 12 aa |
| Standard deviation of domain lengths | 12.36 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 90.84 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.89 |
| Mean intra-cluster local Distance Difference Test score | 0.87 |
| Mean intra-cluster sequence similarity (%) | 40.93 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF00920 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A507R3H6 | 1-110 | MASSNTEATQYTSSTPSTEAKYINFPSLHLTRNMRMAMPFAAGIPDRDTLTKSLQVGIASVWWEGNPCNMHFLDLGKTVKKAIADRG… |
| C4Y276 | 1-76 | MLYATGFKTEDMDKAQIGVGSVWWSGNPCNMHLMDLNDQCTDSVNKAGLKGMQFNSIGVSDGITNGTEGMKFSLQS |
| A0A0D2RLB6 | 31-127 | None |
| A0A1Q9DGX7 | 718-807 | None |
| A0A812TIT0 | 254-327 | None |
| A0A4T0GFF6 | 305-404 | None |
| A0A401KYA4 | 20-131 | None |
| A0A812L994 | 96-201 | None |
| A0A4T0RRS5 | 24-133 | None |
| A0A5N6KXY9 | 513-603 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.