DPCstruct | MC53604
Metacluster Properties and Pfam Annotations
| Number of structural domains | 30 |
|---|---|
| Mean domain length (aa) | 302 ± 37 aa |
| Standard deviation of domain lengths | 37.13 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 66.24 |
| Mean fraction of residues predicted as intrinsically disordered | 0.41 |
| Mean length-normalized TM-Score | 0.43 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 16.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7J7X756 | 8-361 | KSNFKQEDKEQTVLEVTEQLGHCRLDNQEKAAACALPLQKVNTQISSNSFLRENLEASEISENKYHSSEITLVGISKKSAEHFKRKF… |
| A0A183U0K8 | 1-234 | MMLDEAEKLARIRAKYPARKMKKAPIIVEAKPLDLALKARLADTAFEEFEKTAKEWVGNATIAYLRRRGTVDFFDDDALTEAEILMM… |
| A0A2B4SAV2 | 75-343 | None |
| A0A251T060 | 255-536 | None |
| A0A7R9XSX5 | 89-365 | None |
| A0A1S8VP74 | 298-562 | None |
| W4GCL5 | 19-320 | None |
| A0A5B8MQZ1 | 357-647 | None |
| F4P319 | 422-678 | None |
| A0A397IVS5 | 37-309 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.