DPCstruct | MC5360
Metacluster Properties and Pfam Annotations
| Number of structural domains | 56 |
|---|---|
| Mean domain length (aa) | 147 ± 22 aa |
| Standard deviation of domain lengths | 22.36 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 84.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 30.47 |
| Pfam Score | 75.56 |
| Assigned Pfam label(s) | PF17760- PF17755 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D0VX13 | 2-119 | SHMTIEQMVDRLLSYPERTKMQILAPIVSGKKGTHAKTLEDIRKQGYVRVRIDREMRELTGDIELEKNKKHSIDVVVDRIIIKDGIA… |
| H5V939 | 150-300 | IVLAPIIRDKKGSFTDKIAHLRQKGFVRAYIDGVLVRLDEPIELAKSKKHTIKAVLDRLQASLENHARLASALEKALAESFGEVEVM… |
| A0A842T471 | 3-111 | None |
| A0A4Q4WRI9 | 14-177 | None |
| S7WQ32 | 131-291 | None |
| A0A3D2QES1 | 143-297 | None |
| A0A812AGF8 | 136-271 | None |
| F9PAZ4 | 2-126 | None |
| A0A1I7Z2Z7 | 2-119 | None |
| A0A7R9NEP9 | 2-136 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.