DPCstruct | MC536
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 63 ± 4 aa |
| Standard deviation of domain lengths | 3.70 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.42 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 45.44 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2E5A118 | 1-60 | MRIDHDNPDHHVWDNNGTWWLHYVVYPTRATAERRRVSLKTKILEEARSRRDRIFDWFAT |
| A0A2E8STG2 | 5-63 | ISVRVNQKNPNHHLWNNHGTWWLHYTMHLPDYTKRRVRKSLGTRNVEEARHRRDEILAT |
| A0A2D6A4X2 | 4-66 | None |
| A0A2G4FBB6 | 1-56 | None |
| A6DHW6 | 5-63 | None |
| A0A851GA94 | 19-79 | None |
| A0A0E3YUE3 | 6-70 | None |
| A0A143PSP4 | 19-90 | None |
| A0A858RSD6 | 5-62 | None |
| A0A3L7NSB0 | 3-67 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.