DPCstruct | MC53592
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 128 ± 20 aa |
| Standard deviation of domain lengths | 19.73 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 86.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.65 |
| Mean length-normalized TM-Score | 0.75 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 47.88 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF09429 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A4W2I3C1 | 1-131 | LGRRSTSSTKSGKFMNPTDQARKEAQKRELKKNKKQRMMVRAAVLKMKDPKPIIRDMEKLDEMEFNPVQQPQLNEKVLKDKRKKLHE… |
| A0A0R3QUY9 | 1-137 | MGRRPGSTTKSGRFMNPADQERKSMRQKELKRNRKQRTMVRHAILKSKDVDEILENLSRLDDQEFDIHVEHHSKYVFNEKRIKFKQT… |
| A0A4Y7JCB8 | 3-96 | None |
| A0A835G9R6 | 1-142 | None |
| A0A2B4RN59 | 1-139 | None |
| A0A1I8BY33 | 1-125 | None |
| A0A453BL80 | 3-84 | None |
| A0A314YUJ2 | 3-96 | None |
| A0A7R9PP63 | 28-168 | None |
| A0A1D2NCV7 | 1-143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.