DPCstruct | MC5359
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 87.89 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.71 |
| Mean intra-cluster local Distance Difference Test score | 0.66 |
| Mean intra-cluster sequence similarity (%) | 22.41 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A3D6EGZ1 | 15-100 | VPARPAAVPPEARWGGEGRRGVFLKVEGHQGTLWQLHVWDRDGRLLGSGPFRLRGFAKAAIVPEEVLAWENGALQLKDGTWLVPEA |
| A0A1D2XE66 | 12-119 | VLAGCCESTHRIPVRPANISHDAVWAGGSDGGHWFLCKDESYHQYQCNIYNDYDGYIAARGRYTLRSVTWDEKAQKAVYKEAASEPK… |
| A0A7X6V595 | 9-105 | None |
| A0A533ID36 | 34-153 | None |
| A0A3N1JTU5 | 27-135 | None |
| A0A2E6LVX1 | 20-127 | None |
| A0A1C4G8Y5 | 32-128 | None |
| A0A2V9D9G6 | 1-105 | None |
| A0A4P7WUS6 | 118-203 | None |
| A0A1G6X0E6 | 22-122 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.