DPCstruct | MC53588
Metacluster Properties and Pfam Annotations
| Number of structural domains | 115 |
|---|---|
| Mean domain length (aa) | 112 ± 14 aa |
| Standard deviation of domain lengths | 14.26 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 77.91 |
| Mean fraction of residues predicted as intrinsically disordered | 0.27 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 29.54 |
| Pfam Score | 99.35 |
| Assigned Pfam label(s) | CL0001- CL0202 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182YPN4 | 7-112 | TTDYEQQLPKASGLWPSFFNVALRATISVNATCGQTGREEYCRLTTDGTGRSRGSQCGICDANNPDPEKRHPITNIVDGTNSWWQSP… |
| X1X792 | 3-94 | SIPRCIPGFENAAFGLEVEATNTCGQSGPTEFCVQSGSQVTKKTCDVCTESSHSPYYMTDFSSYANRTWWQSETMYESVQYPNQVNL… |
| A0A3P8JCK5 | 3-121 | None |
| A0A7R9AM95 | 12-130 | None |
| A0A6V7WCA2 | 33-149 | None |
| A0A6A4K4F8 | 108-208 | None |
| A0A154NX77 | 170-278 | None |
| G4LWP4 | 5-123 | None |
| A0A7R9A239 | 298-403 | None |
| A0A7R8XGN5 | 118-225 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.