DPCstruct | MC53582
Metacluster Properties and Pfam Annotations
| Number of structural domains | 21 |
|---|---|
| Mean domain length (aa) | 98 ± 15 aa |
| Standard deviation of domain lengths | 14.59 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 77.11 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.60 |
| Mean intra-cluster local Distance Difference Test score | 0.75 |
| Mean intra-cluster sequence similarity (%) | 27.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182Y610 | 18-110 | VLSAVNVSRQASLSLRVLSRGERSVFNQTHSKTCEGNTPCGWAVYVPSTRAIDNFMQNTCDCEKLKQCVRTDDDVSISAYVYRCREH… |
| A0A212FFV0 | 11-89 | LCSMAASMAPRNRREQTSQEPQRYCAPQTPCAWAIYKKPYKNLIEMNVNNTYCVCEPGQTCMQAEENEAASAYVHKCID |
| A0A4U5LTW4 | 59-162 | None |
| A0A7E5WTX1 | 8-107 | None |
| A0A0K0DXM3 | 2-108 | None |
| A0A194RD91 | 17-116 | None |
| A0A7R9FNJ1 | 1-66 | None |
| A0A1B6ESK0 | 7-107 | None |
| A0A0M3HRB2 | 2-84 | None |
| A0A6V7H252 | 74-196 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.