DPCstruct | MC5358
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 318 ± 31 aa |
| Standard deviation of domain lengths | 30.84 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 76.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.34 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.58 |
| Mean intra-cluster sequence similarity (%) | 16.23 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0646 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A838AYE0 | 1-327 | MEQAKEELTFTFSETMESTGHAEHKFEEERVALPHSVIDELDAYLERLPFFDRAELQALLHDIRSGDCAAEDILRQAGQRFADPSFA… |
| A0A1D2XB45 | 1-338 | MASSVQAPIVSQYSPATRQDSGSRIANDATGKAFTGEAVTVKTNAMSPLQKNAEKIANMAEELVQHVKDNKKDLKNRKVKEGTSFSE… |
| A0A2E6M0J0 | 1-327 | None |
| A0A7W0FWC5 | 27-330 | None |
| A0A1B2N6I7 | 5-331 | None |
| A0A081K9I4 | 13-369 | None |
| A0A7R7D9Y7 | 1-242 | None |
| A0A512MAF3 | 1-305 | None |
| A0A1T2Y5T1 | 2-335 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.