DPCstruct | MC53578
Metacluster Properties and Pfam Annotations
| Number of structural domains | 32 |
|---|---|
| Mean domain length (aa) | 169 ± 26 aa |
| Standard deviation of domain lengths | 26.04 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 71.07 |
| Mean fraction of residues predicted as intrinsically disordered | 0.37 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 42.20 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0167 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182Y178 | 15-158 | EDPQSQAQRQASAKLALRKQLEKTLLQIPPPKPPPPEMHFVPNPSNIEFVYLLGLEHVVDYLTKDKKPNPPQQPYRCAQCKIDFTPV… |
| A0A183SZ54 | 250-424 | KVAALQSLEQQCNAKKSVLKKQLERSLEKIPLPRPSAGTGLCEIAFIPSTLTSEFTSLLGLEEVVKNMQEFDPSSTGSQPEPRRTFS… |
| A0A482X716 | 341-538 | None |
| A0A1W0XA65 | 294-489 | None |
| A0A182U4Q0 | 2-113 | None |
| A0A7R9A5B2 | 371-556 | None |
| A0A226EXV5 | 611-752 | None |
| A0A813YB10 | 13-208 | None |
| A0A139WE99 | 218-411 | None |
| A0A0M5JB29 | 424-564 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.