DPCstruct | MC53565
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 88 ± 11 aa |
| Standard deviation of domain lengths | 10.73 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.68 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 28.93 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6L7WA49 | 63-157 | LDDTSRNLLEAELKAIYFVPTISAITSVVAKGTGSQWTVDTDDGEYTFRILGRDALKGDEPPAIEITDENGKRYKIDNYWDLDAESR… |
| A0A4R5YRI8 | 101-177 | VLMVIRIVQVRQHHDQWIWQLETDAGPMRMTMRNLHEQVQLHRANRLLLTDVNGRRAEIRDLQALDGASKKWLKDVL |
| A0A7X6Y1V2 | 18-114 | None |
| A0A2E8H6S1 | 179-273 | None |
| A0A4P5YDV9 | 806-902 | None |
| A0A1F3XSP0 | 194-306 | None |
| A8MDR3 | 778-870 | None |
| A0A0S8FZB2 | 46-140 | None |
| A0A833EMM8 | 73-153 | None |
| A0A7X6W3R5 | 93-172 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.