DPCstruct | MC53564
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 130 ± 14 aa |
| Standard deviation of domain lengths | 14.06 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 88.43 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.69 |
| Mean intra-cluster sequence similarity (%) | 34.70 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A847VCQ7 | 4-149 | AWDRISGVTWFYRNWYRQGYSDSGSTCSRSPWLSQAEMSDILNAYQVWKAHKKSDPRILPVKDACHTNTGQYTHADLLNLAAKPVTS… |
| K2AUN8 | 110-247 | AFDKDSPWFYCDWGSRSQYNKTAWLKSSEIADIANIIILAKADSSASEHLYQTDKPNPAGTETWNEDRVKQELRNRNITPFNNVSSV… |
| A0A2M7QE08 | 305-431 | None |
| A0A0S7Y6C6 | 445-572 | None |
| A0A0G0D608 | 3-127 | None |
| A0A1G1W1F2 | 431-576 | None |
| A0A837IFN1 | 249-373 | None |
| A0A0G1UZM3 | 2-107 | None |
| A0A7X9E7I1 | 156-299 | None |
| A0A1F5FVW8 | 2-104 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.