DPCstruct | MC53559
Metacluster Properties and Pfam Annotations
| Number of structural domains | 53 |
|---|---|
| Mean domain length (aa) | 380 ± 56 aa |
| Standard deviation of domain lengths | 55.53 |
| Length coefficient of variation | 0.15 |
| Mean AlphaFold2 pLDDT confidence score | 83.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.49 |
| Mean intra-cluster local Distance Difference Test score | 0.41 |
| Mean intra-cluster sequence similarity (%) | 14.95 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857EZ34 | 127-516 | KPLSETPQIADNKLRTPGEALITIAGLIRTSSEFLSNKEGLENLIASTWMDGTISRQSSYNTIELIRIKVGANPKLIQEIDNVIDTI… |
| A0A370GYK3 | 103-549 | QFNSRPEAYLYAISWLNQLKVRYPDLLQINQCSEAIKIAFENHERDTQKVADYLADLIPFLSSPDRAALNKIINATLKCNSLKQTAI… |
| A0A849I0F2 | 20-323 | None |
| A0A844TS13 | 308-583 | None |
| A0A2V1BCC4 | 187-575 | None |
| B1FR39 | 75-468 | None |
| C5BCE7 | 192-558 | None |
| A0A3A6TVI5 | 107-427 | None |
| A0A2N7WSC3 | 84-467 | None |
| A0A0W0S442 | 6-351 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.