DPCstruct | MC53554
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 64 ± 5 aa |
| Standard deviation of domain lengths | 5.02 |
| Length coefficient of variation | 0.08 |
| Mean AlphaFold2 pLDDT confidence score | 94.29 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.93 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 52.01 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A6H9HVG1 | 7-70 | VARNGKAVHFEFNRAGTQVWVSDWATDGAVIVLDGNTLDEVARIGDLISPTGKFNVCNTAHEVY |
| A0A7V5C9J2 | 142-206 | PRVVHPEFNMDGDEVWFSVWNGKDKESALVVVDDKTLELIKVIKDPRLITPTGKFNVYNTRNDIY |
| A0A1H4B0P3 | 513-579 | None |
| W8RGH2 | 28-88 | None |
| A0A2E9D6A8 | 41-102 | None |
| A0A7C1TQJ9 | 104-173 | None |
| A0A7C7RYN7 | 9-73 | None |
| A0A7C7RXS7 | 608-682 | None |
| A0A5E7S8L0 | 30-87 | None |
| A0A1G0DL66 | 476-540 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.