DPCstruct | MC53553
Metacluster Properties and Pfam Annotations
| Number of structural domains | 7 |
|---|---|
| Mean domain length (aa) | 100 ± 12 aa |
| Standard deviation of domain lengths | 11.99 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 83.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.33 |
| Mean length-normalized TM-Score | 0.82 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 31.95 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19556 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A840CVU0 | 1-98 | MFKEINEMIAAGQSVSITIHKTGVNMTVTVLHLDNGVKDDAVKKIKPLTLTGTAEELDEGFVSEITRPLQLSGGIISNIAEYEKGVE… |
| A0A522QQD6 | 95-193 | VLSGIIQGLAASLAVKGTLLLAIAKLSDQEILVTIQPTPAEKESHAAAIPLQVAGSPAEIDANLVSALAQYVPARTLSIATAEAIAQ… |
| A7V4T6 | 2-102 | None |
| A0A4Q0IYY2 | 1-80 | None |
| A0A1G7C7F9 | 1-103 | None |
| A0A4V3CCN5 | 2-97 | None |
| G5HBF1 | 2-125 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.