DPCstruct | MC5355
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 107 ± 12 aa |
| Standard deviation of domain lengths | 12.40 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 86.40 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 39.98 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M9RHV9 | 8-102 | TADLVSRYMVLTKEVMPQMARDPAVKWPVRNDHCFQRIILDIVCDGPWFAHLSRPAYKSLSHDQAVRAVQLCEDIIANRVDLYDLNR… |
| A0A098S808 | 3-93 | QWYLLLTREKLPQQAQVEQWPIQQDHCLQRVVLDDLFQDCWYNHLNRSKPAYRQLDNLQLGQSLQLLSRMEREGEPLVAALNVSSLT… |
| A0A1Z5SUA2 | 9-122 | None |
| A0A0G4F6W0 | 258-361 | None |
| A0A7S3F279 | 142-245 | None |
| A0A2A2KJ55 | 243-357 | None |
| A0A218YY21 | 8-118 | None |
| A0A2S7P067 | 2-122 | None |
| A0A357FJD8 | 1-80 | None |
| A0A5C8Z4P3 | 2-115 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.