DPCstruct | MC53545
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 374 ± 60 aa |
| Standard deviation of domain lengths | 59.87 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 85.83 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.55 |
| Mean intra-cluster sequence similarity (%) | 17.32 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A529U627 | 13-385 | AFDEILASLPFQDDLAELVFVGDTRLPILISRYRSKQLVHENGMVRWSETASGSGIQPVAKMVLDPRHEHALEPEAFGLWRFPERCK… |
| A0A411Z1Y3 | 169-544 | LSAWTGLVSQAMALAGADGRLNLRLVKGGETPRLEIGAYDWDAQLRGDLLPLGAGTVTLKAITLSEPFVHRETEAKGPFDLSHWLGD… |
| A0A7W1Q4J1 | 1-308 | None |
| A0A1W2FCN2 | 526-911 | None |
| A0A659YK92 | 18-316 | None |
| A0A2M7ENE6 | 62-454 | None |
| A0A4R7E2C3 | 539-1010 | None |
| A0A7U7J2M4 | 236-647 | None |
| A0A4S5JER4 | 106-510 | None |
| A0A257NAZ4 | 426-795 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.