DPCstruct | MC53544
Metacluster Properties and Pfam Annotations
| Number of structural domains | 14 |
|---|---|
| Mean domain length (aa) | 62 ± 3 aa |
| Standard deviation of domain lengths | 2.95 |
| Length coefficient of variation | 0.05 |
| Mean AlphaFold2 pLDDT confidence score | 90.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.15 |
| Mean length-normalized TM-Score | 0.92 |
| Mean intra-cluster local Distance Difference Test score | 0.91 |
| Mean intra-cluster sequence similarity (%) | 51.03 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1Y4GJL6 | 12-75 | ELKKVVDWSRVDKDDYLLAMERSPIKDVEIKALLKAALTDKIDDRDTYMKGVDASYSYEGYGVY |
| R7H0V4 | 38-100 | LKRTLGKVVNWQFVDKDQYLSAMERSPINDLEIRFLLSQNLTADTENREVIIKGIEQSYYYEG |
| A0A0M4JMW7 | 5-63 | None |
| A0A6G5QH96 | 1-56 | None |
| A0A450TA33 | 385-446 | None |
| A0A139PNP2 | 55-115 | None |
| A0A6A1X420 | 68-132 | None |
| U2V8B8 | 140-202 | None |
| A0A3B8W2U6 | 47-110 | None |
| A0A242KY30 | 1-60 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.