DPCstruct | MC53541
Metacluster Properties and Pfam Annotations
| Number of structural domains | 25 |
|---|---|
| Mean domain length (aa) | 178 ± 19 aa |
| Standard deviation of domain lengths | 19.08 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 75.69 |
| Mean fraction of residues predicted as intrinsically disordered | 0.20 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.67 |
| Mean intra-cluster sequence similarity (%) | 33.83 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| D5ACA5 | 15-178 | GLKHLRIRGLYGLTKDHLDNLKASLDGGLQQQSELVKPQFYHNGHYMFSYHDDRSIDVEVCPKCENARLVYDCPRERCQKKKGHKLQ… |
| Q9ZU90 | 109-291 | ITKIIVPGCSGLTPEGIMECVESLSKNNHKLETLHINGVNGFTKQHLSALYTYLSSEGTIDLEVCPKCDEVRMIPSCSRESCNQKQR… |
| A0A444BX39 | 16-184 | None |
| A0A7C9ENT7 | 375-529 | None |
| A0A022QUA8 | 8-192 | None |
| A0A0E0QJA3 | 130-331 | None |
| A0A540MH83 | 107-285 | None |
| A0A3S3NWS9 | 548-751 | None |
| A0A3S3PR19 | 30-203 | None |
| A0A6J1FZG4 | 706-856 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.