DPCstruct | MC5354
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 62 ± 4 aa |
| Standard deviation of domain lengths | 3.90 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 92.51 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 47.72 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7V5BG13 | 11-77 | LMTGLVGSLTLGLAPFYPEPHIVGKLRWVLGGAVGMQPLDWFDFVLHGAPWVYFIYSLITYIKVKKS |
| A0A098RY05 | 5-66 | NDWKFVLLLCLTLGLAPFYPEPHIWGKIKWIRGGAVGMQALDWFDVVLHGFPWVLLIRLLIR |
| A0A2N6FLH1 | 13-69 | None |
| A0A3D5S487 | 2-59 | None |
| A0A6N9NL22 | 17-77 | None |
| A0A1W7QVB2 | 5-72 | None |
| A0A7D7VLD1 | 3-60 | None |
| A0A521TWX1 | 2-63 | None |
| A0A838IIW5 | 13-80 | None |
| A0A285M639 | 45-106 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.