DPCstruct | MC53535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 273 ± 52 aa |
| Standard deviation of domain lengths | 51.57 |
| Length coefficient of variation | 0.19 |
| Mean AlphaFold2 pLDDT confidence score | 70.86 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.54 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF16879 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7PI73 | 89-345 | RVSTGLRGGVESCGVFYGNDSFFLLFRLHQMLYDRMMSAKLHSSSSANKWKISNGANQTDSYAGFKNALRSLLNGSFDNAKFEDECR… |
| A0A428TE36 | 49-330 | RPWYNFFCNQTLFVFFSIFQTLYKRLQDLKDSKAAVAKEVDRLSKPKPARDIGFTENHMKFFDRNDDPDTYWPKTLELIEEYITGDV… |
| A0A4Q9M974 | 291-654 | None |
| A0A6I9Q1V0 | 399-674 | None |
| A0A5D3DJ15 | 552-799 | None |
| Q6FNH7 | 621-896 | None |
| A0A7S3J495 | 19-338 | None |
| A0A0C2MR01 | 477-726 | None |
| A0A813USI7 | 4-233 | None |
| A0A7N0REP5 | 1033-1202 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.