DPCstruct | MC53534
Metacluster Properties and Pfam Annotations
| Number of structural domains | 8 |
|---|---|
| Mean domain length (aa) | 195 ± 14 aa |
| Standard deviation of domain lengths | 13.54 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 70.95 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.73 |
| Mean intra-cluster sequence similarity (%) | 54.14 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF19160 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5A7PHR8 | 1-209 | MPVLPDDSETCVDTLEKALANKGVQLPGPNATCDVVYCYCGIRLHPFSCPEAFSVNTRGKLVGGESVKRLERDCLNYGHGGGLGGCS… |
| A0A0A0LPW7 | 1-181 | MKPNETCDVVYCYCGIRLHPLSCPEAFSLNQNGILEGNRNVKRLERNCLSSGNVNGFPGLGGCSKCLKSLYQLNKKETLNSSKPENR… |
| A0A151SVD5 | 94-297 | None |
| A0A5N5I5D9 | 119-299 | None |
| A0A426XQK6 | 211-396 | None |
| A0A3L6DY04 | 119-308 | None |
| A0A804UEG2 | 223-413 | None |
| A0A835E6R8 | 119-339 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.