DPCstruct | MC53515
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 133 ± 21 aa |
| Standard deviation of domain lengths | 20.98 |
| Length coefficient of variation | 0.16 |
| Mean AlphaFold2 pLDDT confidence score | 76.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.43 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 44.18 |
| Pfam Score | 89.23 |
| Assigned Pfam label(s) | CL0229- CL0537 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| L1LF10 | 48-190 | MDSRSILERNVEIGKKLLSGELEANVYRGKGAYKPIMNIREGSIAASKYTGLYGPVRASGTNIRTTLRIDYQPDVCKDYKETGYCGF… |
| A0A6G3MGP8 | 3-151 | SLDAQAIFERQLELNKEREGKIDDGMYRGQTAYAKYLTKQDSIMGKASSNLVRQGPFRAAENIRVTTRWDYQQDLCKDYKDTGFCGF… |
| A0A183WI06 | 1-159 | None |
| A0A819TH13 | 6-129 | None |
| A0A1R3J162 | 518-645 | None |
| A0A817RCL3 | 2-135 | None |
| U6MZ77 | 111-228 | None |
| A0A7J6GLQ4 | 386-540 | None |
| A0A2H9TN64 | 83-203 | None |
| A0A7E4W3D2 | 106-241 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.