DPCstruct | MC53513
Metacluster Properties and Pfam Annotations
| Number of structural domains | 136 |
|---|---|
| Mean domain length (aa) | 215 ± 57 aa |
| Standard deviation of domain lengths | 56.75 |
| Length coefficient of variation | 0.26 |
| Mean AlphaFold2 pLDDT confidence score | 83.73 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 21.01 |
| Pfam Score | 97.73 |
| Assigned Pfam label(s) | CL0328- PF16327 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| I3TQ79 | 3-113 | VHVPAAWMAMFSYAGLAVSSAVYLIWRHGVADVTAKAIAPAGAAFTAIALVTGSLWGQPMWGTWWVWDARLTSVLLLFFLYLGYMVL… |
| K1E966 | 28-223 | LFEFSVAGAFFAMATFAVAGLRRDLRWLGVFVTAFVVLLLMVASTAWYVEADEVVPSLKSYWLPIHVTVATLSVGIFVVGAIISALY… |
| A0A534BFP0 | 245-397 | None |
| A0A3T0BWK8 | 16-336 | None |
| A0A6B2M5B9 | 344-579 | None |
| A0A7C4K5W8 | 28-203 | None |
| A0A0E0MN14 | 3-138 | None |
| A0A1V4Y867 | 1-143 | None |
| A0A2X2BYZ0 | 10-150 | None |
| A0A1W1D639 | 15-201 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.