DPCstruct | MC53507
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 317 ± 37 aa |
| Standard deviation of domain lengths | 36.91 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 79.15 |
| Mean fraction of residues predicted as intrinsically disordered | 0.31 |
| Mean length-normalized TM-Score | 0.39 |
| Mean intra-cluster local Distance Difference Test score | 0.47 |
| Mean intra-cluster sequence similarity (%) | 15.21 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0173 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0P6VIZ0 | 11-350 | DWDVWTDWYDDRLAGKRPWRRSLEIARATLPDDLWEQGPKAVNAEIKRLIAAEKAKTAANRRASRDGVQSIGDLEPLDIPSPVSFKW… |
| A0A7W6GNI7 | 218-554 | RKEDKAILARLADATDEDFWGKGAHHVNTTLQGWIDEARAAAELPLPEQEDGATAYDLNDAGQVDRLPASDQQHLRDAPDQRRNYAD… |
| A0A285M2Z9 | 293-643 | None |
| A0A1I3UI51 | 102-381 | None |
| A0A2G6CDR8 | 2-290 | None |
| A0A2E2RPF1 | 207-523 | None |
| A0A2R8B9R7 | 184-465 | None |
| A0A6L6IZ19 | 183-484 | None |
| A0A1H4EUP8 | 745-1091 | None |
| A0A560JHJ0 | 59-382 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.