DPCstruct | MC53500
Metacluster Properties and Pfam Annotations
| Number of structural domains | 20 |
|---|---|
| Mean domain length (aa) | 226 ± 41 aa |
| Standard deviation of domain lengths | 41.22 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 72.85 |
| Mean fraction of residues predicted as intrinsically disordered | 0.16 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 47.76 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MSS1 | 30-210 | LSNYRLEIFSPGSGRDFQDWSKPRKVPVDFSISSSDGKLLSALAEAIFSCVIEDTEKSYFGGTGGFFQSQKLNCSSDSTVCVHRISE… |
| A0A6N2KXR9 | 164-369 | VVLQQIWNFELVVFRPGTERNMKDLDNPREEVPASFFLGSSDEQVISLLAEALCIAALQNTERLFLDDFMGNGSGGFFSWLRKPQRI… |
| A0A067GGH0 | 106-354 | None |
| A0A067GQR5 | 53-253 | None |
| A0A2R6WWI3 | 197-481 | None |
| A0A4S4E203 | 217-415 | None |
| A0A2U1PK67 | 59-256 | None |
| A0A7J8Y4K3 | 4-205 | None |
| A0A368PFC4 | 14-200 | None |
| A0A445BBN9 | 376-681 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.