DPCstruct | MC5350
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 536 ± 50 aa |
| Standard deviation of domain lengths | 49.54 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 86.66 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.67 |
| Mean intra-cluster local Distance Difference Test score | 0.65 |
| Mean intra-cluster sequence similarity (%) | 22.66 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF07752 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1V4V0H3 | 1-627 | MRTPIFALLILLFLATTTSGTAAERVELRGSVAVAYDGATYTWDPQNFPGFSYDADENIGNERLTLTITDSFLEEPMGVVYETTAQL… |
| A0A843KIU9 | 117-704 | QAHDKIEIRGSVASENFTWTADSFPGFYYDIDDNIMTEELTVTVTGRKLLEPYGVVYNTTSMADDFDFENWGTYNVIGFLAEKYFAG… |
| A0A662RI85 | 152-621 | None |
| A0A0E3WUA7 | 2-531 | None |
| A0A7J4FTS5 | 715-1221 | None |
| A0A822JA46 | 42-492 | None |
| D5E9Z1 | 17-581 | None |
| A0A1V5B130 | 22-521 | None |
| A0A843KAS7 | 23-557 | None |
| A0A520K2I6 | 476-1047 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.