DPCstruct | MC535
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 103 ± 9 aa |
| Standard deviation of domain lengths | 9.46 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 91.09 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.78 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 34.04 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1C6FNQ9 | 2-105 | HDLCKANFYKVSTRNVKNEQTGKWEKAPFYQVEDQFPYGHGEKSVFLIERFIRLSTEEAVAIRWHMGGYDEAVKGGSYAQSAAFDKY… |
| R9K2A2 | 26-120 | HDLCKIDAYRLTEGQKGKPEYQLTKNFPAGHGEKSVILILQFMHLTQEEILAIRWHMGQYDFYARGGGYDLDNAFRQSKLAVMLHLA… |
| A0A5E4JNI3 | 89-186 | None |
| A0A843GWR5 | 91-198 | None |
| A0A1H7U8U0 | 5-128 | None |
| A0A496KBJ9 | 89-193 | None |
| A0A0F4VV31 | 2-89 | None |
| A0A2L2WPZ1 | 87-191 | None |
| A0A7U9R9H8 | 1-99 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.