DPCstruct | MC53498
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 98 ± 5 aa |
| Standard deviation of domain lengths | 5.41 |
| Length coefficient of variation | 0.06 |
| Mean AlphaFold2 pLDDT confidence score | 82.81 |
| Mean fraction of residues predicted as intrinsically disordered | 0.39 |
| Mean length-normalized TM-Score | 0.80 |
| Mean intra-cluster local Distance Difference Test score | 0.84 |
| Mean intra-cluster sequence similarity (%) | 48.12 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0063 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MQQ3 | 454-553 | SVVAYDEIQNPTLKNALVLEDAISDLPKVGNDQADDVMEYLVKPKTEFQRYIRLSRKEMLDYSFGDKTGPGEGTLMDHCPLRLNKDD… |
| A0A453MQQ0 | 1-96 | YDEIQNPTLKNALVLEDAISDLPKVGNDQADDVMEYLVKPKTEFQRYIRLSRKEMLDYSFGDKTGPGEGTLMDHCPLRLNKDDYERV… |
| A0A4D9BVN6 | 133-235 | None |
| A0A6P6SPI9 | 545-654 | None |
| A0A5J5BBV5 | 381-478 | None |
| A0A453MQT0 | 222-327 | None |
| A0A2Z6LV84 | 565-663 | None |
| A0A287V462 | 2-103 | None |
| A0A811M7L8 | 435-523 | None |
| A0A446S726 | 90-186 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.