DPCstruct | MC53492
Metacluster Properties and Pfam Annotations
| Number of structural domains | 29 |
|---|---|
| Mean domain length (aa) | 101 ± 11 aa |
| Standard deviation of domain lengths | 11.39 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 82.54 |
| Mean fraction of residues predicted as intrinsically disordered | 0.22 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.80 |
| Mean intra-cluster sequence similarity (%) | 38.40 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0582 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453MGT6 | 2-105 | IWEDILGFENCEFYIKRWPQLVGMQFEDVLISFPDAVPCGIKMASYGGKIILNPDDCYVLQEGDEVIVIAEDDDTYTPSPLPKVRRG… |
| A0A453MGT4 | 1-97 | QIWEDILGFENCEFYIKRWPQLVGMQFEDVLISFPDAVPCGIKMASYGGKIILNPDDCYVLQEGDEVIVIAEDDDTYTPSPLPKVKE… |
| A0A7N2L6Y1 | 90-194 | None |
| C7N3B5 | 273-374 | None |
| A0A2G2WUF6 | 293-399 | None |
| A0A2D5P6R7 | 407-487 | None |
| A0A452Y7X7 | 351-452 | None |
| A0A287F279 | 9-99 | None |
| R1FH86 | 64-163 | None |
| A0A452Y7X1 | 4-116 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.