DPCstruct | MC53489
Metacluster Properties and Pfam Annotations
| Number of structural domains | 45 |
|---|---|
| Mean domain length (aa) | 127 ± 30 aa |
| Standard deviation of domain lengths | 29.77 |
| Length coefficient of variation | 0.23 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.76 |
| Mean intra-cluster local Distance Difference Test score | 0.71 |
| Mean intra-cluster sequence similarity (%) | 41.72 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0036 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A453ME67 | 11-118 | PIRGTHSHAFVSSFLGLDEIIDKALSSSDGSNKCEDFVSLVENWLVKIQGASSLRGSFGETNQSELAAFTSYALAFPNSFLALVDTY… |
| D3BMV1 | 430-562 | SFVTSYNSVSDLVDKTLVGKDGKTYNLFDLALKYRKEMGWTITNESELVAFTAYARTFPNGFLALVDTYDTLNSGVPNYLCLALALN… |
| A0A212CE83 | 29-173 | None |
| A0A445D2U4 | 226-343 | None |
| A0A0E0GW51 | 195-392 | None |
| A0A445C7G5 | 29-129 | None |
| A0A2B4SCW9 | 191-337 | None |
| A0A182TLM5 | 2-94 | None |
| A0A445HXF5 | 173-272 | None |
| A0A6P4E7M5 | 1-101 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.