DPCstruct | MC53488
Metacluster Properties and Pfam Annotations
| Number of structural domains | 50 |
|---|---|
| Mean domain length (aa) | 173 ± 23 aa |
| Standard deviation of domain lengths | 22.79 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 75.82 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.65 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 34.19 |
| Pfam Score | 98.44 |
| Assigned Pfam label(s) | CL0028- PF03169 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| M4EJI8 | 28-191 | ITSVGNICNTNLLPLGSPWTCPGYEVFYNASIIWGVIGPRRMFTKEHIYPGMNWFFLVGILAPVPFWYLSKKFPEKKWLKHIHIPLI… |
| A0A1D6L4S1 | 390-578 | MYTAQLVGTVVAGVVNLAVAWWMLDNIENICDVEALHPDSPWTCPKYRVTFDASVIWGLIGPGRLFGQHGLYRNLVWLFLVGAVLPV… |
| R1G156 | 364-510 | None |
| A0A4S4DPC3 | 341-519 | None |
| A0A4S4CWP1 | 529-731 | None |
| A0A820LPG9 | 1-128 | None |
| A0A2S5B7K2 | 229-399 | None |
| R8BVJ1 | 419-605 | None |
| A0A814TX37 | 165-340 | None |
| A0A4S9T5E0 | 3-166 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.