DPCstruct | MC53487
Metacluster Properties and Pfam Annotations
| Number of structural domains | 35 |
|---|---|
| Mean domain length (aa) | 546 ± 109 aa |
| Standard deviation of domain lengths | 108.73 |
| Length coefficient of variation | 0.20 |
| Mean AlphaFold2 pLDDT confidence score | 76.13 |
| Mean fraction of residues predicted as intrinsically disordered | 0.28 |
| Mean length-normalized TM-Score | 0.44 |
| Mean intra-cluster local Distance Difference Test score | 0.64 |
| Mean intra-cluster sequence similarity (%) | 25.15 |
| Pfam Score | 87.63 |
| Assigned Pfam label(s) | CL0240- CL0221- CL0219 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1L0CXA6 | 1-386 | MRLNNYPVHSSLDEDSHLEDGWVETGEFDHEGSHTFALDCEFCQAKSGPVLTRVSMVNFQNEVIYDTFVKPEEEITDYVTRYSGITA… |
| M4DVG9 | 32-579 | DIYGPQDVQGLVTWVLGEGYMPSWVFIKNKPLIPKVVLLYLPGLDAALYLSQSKELARLKSCCGNPIPLLALSCAVDEMKTIDTILT… |
| T2M7F6 | 71-602 | None |
| A0A7R9A7Q8 | 5-603 | None |
| A0A6A7AE64 | 382-1090 | None |
| A0A2Z6RMB6 | 51-590 | None |
| C1N270 | 2-751 | None |
| A0A3P7DR66 | 86-690 | None |
| A0A061SHQ1 | 1-437 | None |
| I7LTR4 | 76-582 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.