DPCstruct | MC53483
Metacluster Properties and Pfam Annotations
| Number of structural domains | 22 |
|---|---|
| Mean domain length (aa) | 141 ± 26 aa |
| Standard deviation of domain lengths | 26.07 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 79.08 |
| Mean fraction of residues predicted as intrinsically disordered | 0.24 |
| Mean length-normalized TM-Score | 0.70 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.24 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A365NE45 | 2-161 | IYCTLCGIHITAQLGETWLQEFRGIWVESDLVDHVAVSGVGRRSNNDDEIFGIAPDDPKKRYDDDTGPGTTIDVALTPSRPTIFTRS… |
| A0A7C8MW14 | 6-116 | FCCVICGYVIYDYQDPDSASWVNQFRILYSSREIIAVTGVGIYDDPDGDWVAPLDFSARWDDELPATDEIGVLRQPPVDGRYGFPLH… |
| A0A2P2GZW1 | 45-167 | None |
| E4US44 | 1-156 | None |
| A0A4Z0XZ37 | 5-177 | None |
| A0A084RKB3 | 6-168 | None |
| A0A5N7D5Z7 | 11-126 | None |
| A0A401KM52 | 37-140 | None |
| X0KYP4 | 150-277 | None |
| A0A1L9RLN8 | 1-133 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.