DPCstruct | MC53481
Metacluster Properties and Pfam Annotations
| Number of structural domains | 84 |
|---|---|
| Mean domain length (aa) | 207 ± 37 aa |
| Standard deviation of domain lengths | 36.54 |
| Length coefficient of variation | 0.18 |
| Mean AlphaFold2 pLDDT confidence score | 88.31 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.64 |
| Mean intra-cluster local Distance Difference Test score | 0.56 |
| Mean intra-cluster sequence similarity (%) | 27.82 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0199 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A2W4NV48 | 2-226 | QGWASRYWDCCKPHCGWANNVPSRDPMNSCSQSDDVLSNDDVGSACDGGGAFMCHSLAPWAVSNNISFGYIATSAHQDICGRCFQIQ… |
| A0A6A6I0C0 | 13-219 | SLAASGTGKSTRYWDCCKPSCSWPGKADVSNPVTTCDKNNNPLTDYNAKSGCDSGTSYMCASQIPWAVNSALAFGFAATAISGQTES… |
| A0A0V0QE70 | 23-268 | None |
| A0A7S2ADQ3 | 1-187 | None |
| A0A7R8X384 | 3-158 | None |
| A0A084R6U7 | 538-752 | None |
| A0A061RDJ6 | 279-502 | None |
| M9LKH3 | 21-236 | None |
| A0A7S2CZ55 | 11-195 | None |
| A0A0S6XBN8 | 31-247 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.