DPCstruct | MC5348
Metacluster Properties and Pfam Annotations
| Number of structural domains | 41 |
|---|---|
| Mean domain length (aa) | 92 ± 10 aa |
| Standard deviation of domain lengths | 10.25 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 87.00 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.77 |
| Mean intra-cluster local Distance Difference Test score | 0.72 |
| Mean intra-cluster sequence similarity (%) | 32.11 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7X3UYG7 | 3-91 | IPPNVEDRSIPKASGRVRLPQHIAWSEPFEYDLDDRCQLLLMYAQVMTEGLEEDVLHYIDLDVLLGAWDELCLSPYVREAWSKWLGE… |
| A0A841FKI9 | 79-163 | PDHLPRLEVREAFATVVLPLHLNWSEPARVFELADRRQRARVYEIVLREGTPVDIVTYVDGALLADLWDELVLPRDVRTAWTPLL |
| A0A1G9PT11 | 6-107 | None |
| A0A7W7DC35 | 9-105 | None |
| A0A7Z0DM73 | 4-69 | None |
| A0A7Z0ISR5 | 27-132 | None |
| A0A1C6TBZ0 | 74-184 | None |
| A0A367HJ87 | 13-100 | None |
| A0A1Q3Q7C2 | 52-141 | None |
| A0A5C7YU64 | 4-89 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.