DPCstruct | MC53475
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 188 ± 20 aa |
| Standard deviation of domain lengths | 20.45 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 89.87 |
| Mean fraction of residues predicted as intrinsically disordered | 0.23 |
| Mean length-normalized TM-Score | 0.72 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 25.69 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A223M901 | 1-179 | MAYWTRNNEKVFQGSWGPGLSPDIKESENSYPTGLDLTRVKKMKSLKGLIFSDQQKSTNSKPRRLTRIGLYNDSENFEIPVDELNHA… |
| A0A502M2H2 | 155-341 | NSTPRASSIVFDTIRPAKTDSFSEIQEGFRLAYTTRKNWRIFNGSMGDGSWISRIDLSLHPELRGLKGLDLNDKVFNRLTLANSSNV… |
| A0A3B0P099 | 2-209 | None |
| N9SR00 | 383-588 | None |
| A0A3B0PSI3 | 1-144 | None |
| A0A7D7U454 | 469-649 | None |
| A0A7Z7GGL6 | 1-172 | None |
| A0A223M8Z3 | 227-439 | None |
| A0A3B0Q623 | 24-227 | None |
| A0A168RKS3 | 968-1143 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.