DPCstruct | MC5346
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 272 ± 26 aa |
| Standard deviation of domain lengths | 25.57 |
| Length coefficient of variation | 0.09 |
| Mean AlphaFold2 pLDDT confidence score | 88.67 |
| Mean fraction of residues predicted as intrinsically disordered | 0.18 |
| Mean length-normalized TM-Score | 0.73 |
| Mean intra-cluster local Distance Difference Test score | 0.68 |
| Mean intra-cluster sequence similarity (%) | 27.42 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A517DNU0 | 210-497 | DSNRLAVALVGNIFVLSLPVARLMNQNLIPGCVVTDSLVDKLAAEAAQSNKKELQLLRAAKLYAVLKGLKYDGVNIGGHGLGYTEVQ… |
| A0A7X3TPQ8 | 36-341 | MALCGLDVPVIANVYVLSRPAARFFHKGHIPGVEVTDELMAVVEKQAQANDKGRAFFLELAAKQCAIAKGLGYRGAYLGGHLQYGDY… |
| A0A127QRJ3 | 101-389 | None |
| A0A1V4XWI7 | 16-291 | None |
| A0A7X7YY92 | 61-342 | None |
| A0A8B5S8G5 | 157-427 | None |
| A0A2E8H907 | 547-838 | None |
| A0A829HCV3 | 3-263 | None |
| A0A432UID8 | 1-208 | None |
| A0A1F5ESC3 | 196-436 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.