DPCstruct | MC53455
Metacluster Properties and Pfam Annotations
| Number of structural domains | 19 |
|---|---|
| Mean domain length (aa) | 196 ± 14 aa |
| Standard deviation of domain lengths | 13.57 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 90.60 |
| Mean fraction of residues predicted as intrinsically disordered | 0.25 |
| Mean length-normalized TM-Score | 0.68 |
| Mean intra-cluster local Distance Difference Test score | 0.54 |
| Mean intra-cluster sequence similarity (%) | 17.33 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A0H5Q447 | 32-217 | IRVMLRVVTVLTGKPGSPWYSTLYFEGAISTEAQDAVDQVDVLWGNLTSVMVAGITATIEPFVASIDPATGDVIGGFVTTPAAPQVG… |
| A0A0H5Q1X1 | 3-167 | TESSSVLADVDTAFQAFALAFVGGSMAALWSTETQCTGVQTTQLDPVSGKNVAQINTTVNYKGTGSGNALPQRASLVLGLRTDTPTR… |
| A0A0H5Q618 | 35-229 | None |
| A0A3N9UFD7 | 101-289 | None |
| A0A0H5QK03 | 6-203 | None |
| A0A0H5QDC4 | 2-185 | None |
| A0A0H5Q7F3 | 1-203 | None |
| A0A0H5Q790 | 5-209 | None |
| A0A0H5Q5J0 | 79-264 | None |
| A0A0H5Q6N1 | 12-194 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.