DPCstruct | MC53452
Metacluster Properties and Pfam Annotations
| Number of structural domains | 60 |
|---|---|
| Mean domain length (aa) | 170 ± 23 aa |
| Standard deviation of domain lengths | 23.14 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 74.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.40 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.49 |
| Mean intra-cluster sequence similarity (%) | 14.09 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1D7TQR7 | 23-214 | GNKSAESQAQTSAHESSVVVKKSHKKSAIKAKAVFAEDADVADNTSKSSKSSSVDSEKVNPNGSSSSSKALASSADELTEQQQAALT… |
| A0A430AFA6 | 42-167 | YTDEQIEYASVWLSLGVNQQIDELNVLRIPAGTLINPNDTSSAVYPVNTIQLCGSRLIDASVTYSRNNDGTITVYNVPQRWEANLPE… |
| A0A1H7XNH7 | 28-215 | None |
| A0A4Y4G6U6 | 3-210 | None |
| T0U3P5 | 108-279 | None |
| A0A0R1WRE7 | 1-172 | None |
| A0A1E5KVA2 | 291-423 | None |
| A0A2A5RJ72 | 1-196 | None |
| A0A3F3GVJ6 | 58-220 | None |
| A0A7W3YNU5 | 11-188 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.