DPCstruct | MC5345
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 61 ± 4 aa |
| Standard deviation of domain lengths | 4.10 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 80.98 |
| Mean fraction of residues predicted as intrinsically disordered | 0.19 |
| Mean length-normalized TM-Score | 0.90 |
| Mean intra-cluster local Distance Difference Test score | 0.89 |
| Mean intra-cluster sequence similarity (%) | 86.86 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0123 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A5K4FB54 | 630-690 | GTPVNRIPIMAKQVLDLYELFQLVVARGGLVEVINKKLWREITKGLNLPSSITSAAFTLRT |
| A0A1B0GM00 | 7-67 | RTPINRLPIMAKSVLDLYELYNLVIARGGLVDVINKKLWQEIIKGLHLPSSITSAAFTLRT |
| A0A813M5T9 | 283-343 | None |
| A0A310SUK6 | 191-251 | None |
| A0A3B0IYM3 | 290-350 | None |
| A0A6A4VZS9 | 92-163 | None |
| A0A6A7FU97 | 18-78 | None |
| A0A7R8UBQ5 | 240-300 | None |
| A0A6P3XEL0 | 314-374 | None |
| A0A7I0ZFK0 | 61-121 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.