DPCstruct | MC53447
Metacluster Properties and Pfam Annotations
| Number of structural domains | 171 |
|---|---|
| Mean domain length (aa) | 143 ± 30 aa |
| Standard deviation of domain lengths | 29.72 |
| Length coefficient of variation | 0.21 |
| Mean AlphaFold2 pLDDT confidence score | 74.28 |
| Mean fraction of residues predicted as intrinsically disordered | 0.32 |
| Mean length-normalized TM-Score | 0.36 |
| Mean intra-cluster local Distance Difference Test score | 0.63 |
| Mean intra-cluster sequence similarity (%) | 22.47 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0481 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A378NII6 | 24-174 | VAAEAHESHKLEKLCRYITRPAISEQRLSISPQGRVRYQLKTPWRNGTTHVEWDAVDFIAKLAALVPPPRAHLTRFHGVFAPNANLR… |
| A0A4P9VHW8 | 1-114 | MAHYDGHCVIFNYLDHNTKTHRRFECTAEDFMTRLTQHIPEKGFRLIRYYGFLANRVRGKLLPKVYRLLDQPEKNAQPLHWPELLKA… |
| A0A523I2I8 | 4-107 | None |
| A0A1Q8YAI8 | 25-179 | None |
| A0A7C1N954 | 5-98 | None |
| A0A3P1VLJ3 | 6-99 | None |
| A0A6N7SD30 | 256-395 | None |
| A0A3L7PHU2 | 58-257 | None |
| A0A518HI21 | 209-364 | None |
| A0A518HX45 | 2-142 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.