DPCstruct | MC5344
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 109 ± 12 aa |
| Standard deviation of domain lengths | 11.65 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 72.37 |
| Mean fraction of residues predicted as intrinsically disordered | 0.56 |
| Mean length-normalized TM-Score | 0.42 |
| Mean intra-cluster local Distance Difference Test score | 0.74 |
| Mean intra-cluster sequence similarity (%) | 48.83 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | PF04180 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A7R9NXF3 | 41-143 | RGKKKFIDHKNAITFSLVHRSQQDPLVTDETAPQHVLVPSGEKQSKDEVEKRKEEERKFGVFFDDDYNYLNHLFDIRKSAVEWESVE… |
| A0A1B0EZN7 | 27-107 | GKRRRFIDKKNSVTFHVVNRSQQDPLIADETAPQHVLMEVAPTQKEKQKEDQAKYGIYFDDDYDYLQHLRPRGQVVWECVE |
| A0A653BDI9 | 1-109 | None |
| A0A4Y7M5Q4 | 294-415 | None |
| A0A212C7G0 | 3-120 | None |
| B4DTT8 | 1-118 | None |
| A0A7F8RSF8 | 46-158 | None |
| A0A4Y7LW07 | 316-439 | None |
| A0A1V9X271 | 2-119 | None |
| A0A820LIS9 | 6-103 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.