DPCstruct | MC53433
Metacluster Properties and Pfam Annotations
| Number of structural domains | 11 |
|---|---|
| Mean domain length (aa) | 116 ± 15 aa |
| Standard deviation of domain lengths | 15.25 |
| Length coefficient of variation | 0.13 |
| Mean AlphaFold2 pLDDT confidence score | 85.93 |
| Mean fraction of residues predicted as intrinsically disordered | 0.17 |
| Mean length-normalized TM-Score | 0.83 |
| Mean intra-cluster local Distance Difference Test score | 0.77 |
| Mean intra-cluster sequence similarity (%) | 33.81 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A857D985 | 53-161 | LGDETTATANTPQNYLNFLMETLRKVQENPNPQVIYPFWAQNLDKLDENLIYILDSWANDKLASVDTKEAYFIAGNIWYFSELVQKF… |
| A0A1D9G1R0 | 1-100 | MNDAQIYFLLQVLQATADSNGDAQIVYPLLADNTDKINPRLAELLRVVTTTKLAEVEADEAEYLAAVIVEFSNLIQQFPLGDKASNS… |
| A0A6P0RLU9 | 48-163 | None |
| A0A6P0WVR2 | 59-182 | None |
| A0A1J5G3A4 | 22-145 | None |
| A0A7C9TWH7 | 11-161 | None |
| A0A352XGA0 | 1-127 | None |
| A0A1Z4S1E7 | 224-344 | None |
| A0A1C0VUG5 | 90-186 | None |
| A0A0F6RMP2 | 79-179 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.