DPCstruct | MC53430
Metacluster Properties and Pfam Annotations
| Number of structural domains | 16 |
|---|---|
| Mean domain length (aa) | 102 ± 12 aa |
| Standard deviation of domain lengths | 12.25 |
| Length coefficient of variation | 0.12 |
| Mean AlphaFold2 pLDDT confidence score | 87.04 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.86 |
| Mean intra-cluster local Distance Difference Test score | 0.78 |
| Mean intra-cluster sequence similarity (%) | 31.22 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A845YT80 | 1-114 | MATVRYPNRTRYLSAVHHPQIAFKNLDQKLAAGKPVETKNAQGIKDLWFAAGGFACVFQYQTFNPNKRWAVRCFLQSTSSVANHYSR… |
| A0A0K8QPN2 | 1-95 | MAYPSLEQYNQAFSAHGTLLADPELRAGTLAKSGLGLPLAISGGFALTYTVSTARGKFAVRCFHRESKGLERRYAAISKKLASLRSP… |
| A0A7V1Z5Z9 | 2-107 | None |
| A0A7V8AKX0 | 1-106 | None |
| A0A5Q4GYE9 | 1-83 | None |
| A0A537MPR5 | 1-102 | None |
| A0A3A5YGD3 | 6-89 | None |
| A0A1U7HE64 | 1-134 | None |
| A0A2W4I7M3 | 1-101 | None |
| A0A1V6GY05 | 453-565 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.