DPCstruct | MC5343
Metacluster Properties and Pfam Annotations
| Number of structural domains | 9 |
|---|---|
| Mean domain length (aa) | 56 ± 4 aa |
| Standard deviation of domain lengths | 4.09 |
| Length coefficient of variation | 0.07 |
| Mean AlphaFold2 pLDDT confidence score | 86.17 |
| Mean fraction of residues predicted as intrinsically disordered | 0.35 |
| Mean length-normalized TM-Score | 0.87 |
| Mean intra-cluster local Distance Difference Test score | 0.88 |
| Mean intra-cluster sequence similarity (%) | 66.75 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A182FBG9 | 10-66 | STRDRHVKKHGDGQPLVDSSQDYVLLLGYENQTHTVLRFKRKLDTCDVAYDVPITKS |
| A0A084WGU4 | 9-65 | TDDRHIRADSDGEPLVDPSQDYRMQFGFVNQTHTVFRFKRNLDTCDMKDDFPITIEE |
| A0A182FBF9 | 1-60 | None |
| A0A182WEN2 | 1-60 | None |
| A0A7R9B876 | 1-53 | None |
| A0A4Y0BM44 | 97-149 | None |
| A0A182PN28 | 1-59 | None |
| A0A182MXM9 | 16-74 | None |
| A0A834JZ14 | 1-47 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.