DPCstruct | MC53425
Metacluster Properties and Pfam Annotations
| Number of structural domains | 13 |
|---|---|
| Mean domain length (aa) | 57 ± 10 aa |
| Standard deviation of domain lengths | 9.93 |
| Length coefficient of variation | 0.17 |
| Mean AlphaFold2 pLDDT confidence score | 76.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.84 |
| Mean intra-cluster local Distance Difference Test score | 0.85 |
| Mean intra-cluster sequence similarity (%) | 58.99 |
| Pfam Score | 0.00 |
| Assigned Pfam label(s) | UNKNOWN |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A383RNM5 | 1-58 | MRQRSSYPKLFKAQVVQECLRLGATVSSVSISHGINANVIRKWMPLYRDPPGAASLPA |
| A0A7W4T0F8 | 1-41 | MRQRSSYPKPFKAQVVQECLQPGATLSSVAIRHGINANVIR |
| A0A0Q5END2 | 1-60 | None |
| A0A4P6G525 | 41-109 | None |
| A0A239C695 | 1-48 | None |
| A0A1H4KXE2 | 102-161 | None |
| A0A5C5NLS7 | 2-54 | None |
| A0A6I1VLH9 | 1-70 | None |
| A0A010RT90 | 1-57 | None |
| A0A0P7X8Q9 | 44-120 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.