DPCstruct | MC5342
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 101 ± 10 aa |
| Standard deviation of domain lengths | 10.06 |
| Length coefficient of variation | 0.10 |
| Mean AlphaFold2 pLDDT confidence score | 82.41 |
| Mean fraction of residues predicted as intrinsically disordered | 0.26 |
| Mean length-normalized TM-Score | 0.81 |
| Mean intra-cluster local Distance Difference Test score | 0.76 |
| Mean intra-cluster sequence similarity (%) | 42.24 |
| Pfam Score | 100.00 |
| Assigned Pfam label(s) | CL0489 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A1B0DPH2 | 1-108 | MVVESVNRQSGHLKMQPTGMTPKELSENDDLATSLVLDPFLGFVTHKMNIKYRPLKANRDELKRIVAEFIETKNYEKAYSKIIKGEW… |
| A0A183V5H7 | 1-91 | MTAQELCDNDDLATSVIVDTMLGFKTHKMSLSYEPPDARERRKLKKVLKAYIREQNLSNTMAKLLRAPCVCSFMCQLDMRQQINFRD… |
| G3UF27 | 1-93 | None |
| A0A482V1B1 | 1-116 | None |
| A0A819RYQ7 | 12-94 | None |
| B0XG69 | 122-223 | None |
| A0A5N4DT27 | 30-145 | None |
| A0A1I7XQF3 | 21-126 | None |
| A0A6P5ADR4 | 1-109 | None |
| A0A7N5JSC9 | 261-350 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.