DPCstruct | MC53418
Metacluster Properties and Pfam Annotations
| Number of structural domains | 12 |
|---|---|
| Mean domain length (aa) | 551 ± 75 aa |
| Standard deviation of domain lengths | 74.72 |
| Length coefficient of variation | 0.14 |
| Mean AlphaFold2 pLDDT confidence score | 81.30 |
| Mean fraction of residues predicted as intrinsically disordered | 0.21 |
| Mean length-normalized TM-Score | 0.62 |
| Mean intra-cluster local Distance Difference Test score | 0.60 |
| Mean intra-cluster sequence similarity (%) | 22.60 |
| Pfam Score | 88.33 |
| Assigned Pfam label(s) | PF12807- PF13236 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| S9UDX4 | 1-636 | MAKNWNLRYQVAIENLLYNKKVSNSKAEEELHQLKAEFEGVAQELAATVLGELVQSAAQRRVSAHPTHTNYFYESDGMLLQLCIDKS… |
| A0A2P6NGF0 | 192-730 | KEKMMRVHNHDHHLSIVSPFRDWNEEYQTWYHRLVSIMNQQKNPYKLRMDHEVLYNINRVAQQFADTATIYAKIIISEFELPLERKT… |
| A0A444SUN8 | 198-652 | None |
| Q54ZA9 | 509-1045 | None |
| A0A3P7NNG7 | 1-419 | None |
| S9TPC9 | 207-839 | None |
| A0A0K0E7J3 | 1013-1636 | None |
| L8HJK0 | 182-652 | None |
| A0A4Z2CTG6 | 313-807 | None |
| L8GHQ3 | 393-1006 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.