DPCstruct | MC53417
Metacluster Properties and Pfam Annotations
| Number of structural domains | 15 |
|---|---|
| Mean domain length (aa) | 682 ± 74 aa |
| Standard deviation of domain lengths | 74.35 |
| Length coefficient of variation | 0.11 |
| Mean AlphaFold2 pLDDT confidence score | 77.19 |
| Mean fraction of residues predicted as intrinsically disordered | 0.30 |
| Mean length-normalized TM-Score | 0.57 |
| Mean intra-cluster local Distance Difference Test score | 0.62 |
| Mean intra-cluster sequence similarity (%) | 26.39 |
| Pfam Score | 82.78 |
| Assigned Pfam label(s) | CL0020- PF12807- PF13236- PF05303 |
Seed Sequences
Each DPCstruct metacluster stores at most two representative sequences: the cluster center and the member with the highest pLDDT confidence score. When both point to the same domain, only one entry is shown.
| Protein ID | Range | Seed Sequence |
|---|---|---|
| A0A444SUN8 | 110-760 | GDLLYLYVVTLEGRRYHITACTWGFFVNQSTDDEFNPKPANPCYLSHSLVDLLNHISSMFKRNFANLLKKRTSRHPFERVPTPYQVH… |
| A0A0K0E7J3 | 890-1653 | IKAFNYVGISPFNPPTPQRKLKGDVLYIFVETLEGKSYNITCSYKGWFVNSTSGYKFNSEQSPQHPSIFHELPDLLMTISLGFKKLW… |
| A0A072TRB0 | 3-573 | None |
| E7FE02 | 627-1386 | None |
| H3HDX6 | 355-1093 | None |
| A0A0V1Q2H5 | 7-584 | None |
| A0A437CQY0 | 199-958 | None |
| A0A3Q1EZR2 | 236-888 | None |
| A0A453PEY2 | 182-800 | None |
| K7KZV0 | 185-926 | None |
3D Structure Viewer
A maximum of two representative PDB files is stored per metacluster: the cluster center or the highest-pLDDT member. You can switch from them when possible.
AlphaFold Confidence (pLDDT)
Very high (pLDDT > 90)
High (90 > pLDDT > 70)
Low (70 > pLDDT > 50)
Very low (pLDDT < 50)
pLDDT is a per-residue measure of local confidence.